Wuhan More Biotechnology Co., Ltd

Sequence: VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK [Disulfide Bridges: ***7, ****2, ****4] Source description: R

Tamapin is a *1 amino acid peptidyl toxin, isolated from the venom of the Indian red scorpion, Mesobuthus tamu

Native Tertiapin was originally isolated from Apis mellifera bee venom. Native and synthetic Tertiapin blocks

OsK1 (-KTx3.7) is a **-residue toxin cross-linked by three disulphide bridges, originally isolated from the ve

Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK M.W.: ***7.4Da. Purity: more than o

Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD. M.W.: ***1Da. Purity: more than or equal to *8% (HP

Sequence: GVPCL CDSDG PSVRG NTLSG IIWLA GCPSG WHNCK KHGPT IGWCC KQ M.W.: ***5 Purity: more than or equal

M.W.: ***9.4Da. Purity: more than or equal to *8% (HPLC) Form: lyophilized powder: Storage temp .: minus

Sequence: AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH [Disulfide Bridges: ***1, ***6, ****8] Molecular Weight: ***4 Da

Sequence: QNETN KKCQG GSCAS VCRRV IGVAA GKCIN GRCVC YP M.W.: ***8 Da. Purity: more than or equal to *8%

Sequence: QFTQE SCTAS NQCWS ICKRL HNTNR GKCMN KKCRC YS M.W.: ***3Da. Purity: more than or equal to *8% (

Source description: expressed in Escherichia coli Purity: great than *8% Form: lyophilized powder Storage

Sequence: ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS M.W.: ***7.5 Da. Purity: greater than *8% (HPLC) Form: lyo

Sequence: VGINVKCKHSGQCLKPCKDAGMRFGKCINGKCDCTPK [Disulfide Bridges: ***7, ****2, ****4] Molecular Weight: *

Sequence: RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF[Disulfide Bridges: ***8, ****3, ****5] Molecular Weight: ***2

Sequence: DRDSC VDKSR CAKYG YYQEC QDCCK NAGHN GGTCM FFKCK CA M.W.: ***0 Da. Purity: more than or equal

Sequence: EFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ [Disulfide Bridges: ***8, ****3, ****5] Description: Iberio

Native Agitoxin*2 was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.

Voltage-gated channel (Kv1.3 and Kv1.1) blocker. ADWX*1 blocks Kv1.3 channels with IC*0 of 0.***9 nM, and inh

Maurocalcine (MCa), is a peptidyl toxin originelly isolated from the venom of the scorpion Scorpio maurus palm

More Biotech is one of the few firms which can provide total solution of peptide services, in terms of gene en

Chlorotoxin is an inhibitor of Cl-channels in colonic epithelial cells and inhibits Cl- fluxes across glioma c