¿Aún no es miembro de TradeKey.com? Regístrese para conectarse con 9 millones de importadores y exportadores a nivel mundial.
registro |
User Ingrese Inscríbase Gratis
Live Chat Live Chat
❯
BOOK A CALL
Book Call On Your Favorite Time

By Signing Up. I agree to TradeKey.com Terms of Use, Privacy Policy, IPR and receive emails related to our services

❯
Contact Us
Sell rChlorotoxin

Sell rChlorotoxin

FOB Price

Obtener el precio más reciente

|

Minimum Order

Place of Origin:

Made in China

Price for Minimum Order:

-

Minimum Order Quantity:

-

Packaging Detail:

Lyophilized powder

Delivery Time:

-

Supplying Ability:

-

Payment Type:

T/T

Contactar ahora
Wuhan More Biotechnology Co., Ltd

Wuhan More Biotechnology Co., Ltd

China

Miembro Básico

Persona de contacto Ms. Betty

Room No.201,BD.-B, Qifeng Building of Internation Enterprises Centre,the 2nd Guanshan Road,Hongshan, Wuhan, Hubei

Contactar ahora

Description

Sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR [Disulfide Bridges: ***9, ***8, ****3,****5]
Molecular Weight: ***6Da
Source description:expressed in Escherichia coli
Purity:greater than *8%
Description:Chlorotoxin is an inhibitor of Cl-channels in colonic epithelial cells and inhibits Cl- fluxes across glioma cell membranes.

Send a direct inquiry to this supplier

A:

Ms. Betty < Wuhan More Biotechnology Co., Ltd >

quiero saber:

Get Verified Buyers & Suppliers

Avail Free Consultation

By Signing up. I agree to TradeKey.com Terms of Use, Privacy Policy, IPR and receive emails related to our services

no thanks