Please enter full name.
Please enter product name.
Select Industry.
Email address already exists
Please enter Password.
Enter Conatct number.
Please enter company name.
Please enter date.
Enter Message
By Signing Up. I agree to TradeKey.com Terms of Use, Privacy Policy, IPR and receive emails related to our services
Thank you, your message has been sent.
Invalid Email.
chuansha,Shanghai,Shanghai,China China
ACTH (***1), human MEHFRWGK *****1
custome peptides only need you provide sequence. Range of Services 1 Linear peptide: less than *0 residue
Range of Services 1 Linear peptide: less than *0 residues, quantity from mg to kg, purity can reach *9%
-Amyloid (***0) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Beta-amyloid peptide (beta-APP) is a **-residue pe
Persona de contacto Ms. Angie Cui
Dirección chuansha, Shanghai, Shanghai
We will contact you soon .
Please select at least one Buyer/Supplier.
Please enter name.
Please select industry.
Enter Password
Please select country.
Please select state.
Please select city.
Please Enter Message.
